PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn093421
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 311aa    MW: 34064.1 Da    PI: 6.5903
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn093421genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.12.2e-29147200155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 +prl+Wt++LH+rFv++v++L G++ A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Achn093421 147 RPRLVWTSQLHKRFVDVVAHL-GIKSAVPKTIMQLMNVEGLTRENVASHLQKYRL 200
                 59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.209144203IPR017930Myb domain
SuperFamilySSF466894.48E-19144204IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-29146205IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-24148200IPR006447Myb domain, plants
PfamPF002493.5E-7150199IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MGEEVRMSEC DGVDDDGCAG DDDRVSEWEV GLPNADDLTP LSQPLIPPEL ASAFSILPEP  60
RRRMIDVNRA SQNTLSSIRG ESQALSSSSK FKFKSFSEDR AKDGVVVEGD EADRRKVRRI  120
DGSSEEADSA LRAENGGDDP SARTLKRPRL VWTSQLHKRF VDVVAHLGIK SAVPKTIMQL  180
MNVEGLTREN VASHLQKYRL YLKRMQGLSS EGPSSSDHLF ASTPVRQSLH ESGGSGNGHV  240
AMPIPMPYRP QMMHMPVMGM AHGHGHMGMP VGNPGSYQGF ESYNMVQQRD WSGNKFGSSA  300
SYPHVTPNDK *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-20146205463ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002283159.11e-145PREDICTED: transcription factor PCL1
RefseqXP_010650997.11e-145PREDICTED: transcription factor PCL1
RefseqXP_010650998.11e-145PREDICTED: transcription factor PCL1
SwissprotQ9SNB42e-87PCL1_ARATH; Transcription factor LUX
TrEMBLF6GUZ01e-145F6GUZ0_VITVI; Putative uncharacterized protein
STRINGVIT_06s0004g05120.t011e-144(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35802343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.24e-77G2-like family protein